Lineage for d6dx7d2 (6dx7 D:241-395)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2918090Species Physcomitrella patens [TaxId:3218] [358908] (1 PDB entry)
  8. 2918098Domain d6dx7d2: 6dx7 D:241-395 [358916]
    automated match to d4yjyb2

Details for d6dx7d2

PDB Entry: 6dx7 (more details), 2.61 Å

PDB Description: crystal structure of chalcone synthase from physcomitrella patens
PDB Compounds: (D:) chalcone synthase

SCOPe Domain Sequences for d6dx7d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dx7d2 c.95.1.0 (D:241-395) automated matches {Physcomitrella patens [TaxId: 3218]}
plfevhwagetilpesdgaidghlteaglifhlmkdvpgliskniekflnearkpvgspa
wnemfwavhpggpaildqveaklkltkdkmqgsrdilsefgnmssasvlfvldqirhrsv
kmgastlgegsefgffigfgpgltlevlvlraapn

SCOPe Domain Coordinates for d6dx7d2:

Click to download the PDB-style file with coordinates for d6dx7d2.
(The format of our PDB-style files is described here.)

Timeline for d6dx7d2: