Lineage for d6dq0b_ (6dq0 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508387Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2508388Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2508389Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2508715Protein automated matches [190406] (18 species)
    not a true protein
  7. 2508906Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (39 PDB entries)
  8. 3058849Domain d6dq0b_: 6dq0 B: [358911]
    automated match to d3srya_
    complexed with edo, na

Details for d6dq0b_

PDB Entry: 6dq0 (more details), 2.05 Å

PDB Description: sfgfp d133 mutated to 4-nitro-l-phenylalanine
PDB Compounds: (B:) superfolder green fluorescent protein

SCOPe Domain Sequences for d6dq0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dq0b_ d.22.1.1 (B:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
ttlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvn
rielkgidfkefgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladh
yqqntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagith

SCOPe Domain Coordinates for d6dq0b_:

Click to download the PDB-style file with coordinates for d6dq0b_.
(The format of our PDB-style files is described here.)

Timeline for d6dq0b_:

  • d6dq0b_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18