Lineage for d6d4fa_ (6d4f A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2454571Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2454572Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2455001Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2455002Protein automated matches [190475] (9 species)
    not a true protein
  7. 2455014Species Human (Homo sapiens) [TaxId:9606] [187400] (121 PDB entries)
  8. 3058842Domain d6d4fa_: 6d4f A: [358904]
    automated match to d3b7oa_
    complexed with 1pe

Details for d6d4fa_

PDB Entry: 6d4f (more details), 1.91 Å

PDB Description: crystal structure of ptp epsilon d2 domain (a455n/v457y/e597d)
PDB Compounds: (A:) receptor-type tyrosine-protein phosphatase epsilon

SCOPe Domain Sequences for d6d4fa_:

Sequence, based on SEQRES records: (download)

>d6d4fa_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gleeefrkltnvrimkenmrtgnlpanmkknryiqiipydfnrvilsmkrgqeytdyina
sfidgyrqkdyfiatqgplahtvedfwrmiwewkshtivmltevqereqdkcyqywpteg
svthgeitieikndtlseaisirdflvtlnqpqarqeeqvrvvrqfhfhgwpdigipaeg
kgmidliaavqkqqqqtgnhpitvhcsagagrtgtfialsnilervkaeglldvfqavks
lrlqrphmvqtleqyefcykvvqdfidifs

Sequence, based on observed residues (ATOM records): (download)

>d6d4fa_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gleeefrkltnvrimkenmrtgnlpanmkknryiqiipydfnrvilsmkgqeytdyinas
fidgyrqkdyfiatqgplahtvedfwrmiwewkshtivmltevqereqdkcyqywptegs
vthgeitieikndtlseaisirdflvtlnqpqarqeeqvrvvrqfhfhgwpdigipaegk
gmidliaavqkqqqqtgnhpitvhcsagagrtgtfialsnilervkaeglldvfqavksl
rlqrphmvqtleqyefcykvvqdfidifs

SCOPe Domain Coordinates for d6d4fa_:

Click to download the PDB-style file with coordinates for d6d4fa_.
(The format of our PDB-style files is described here.)

Timeline for d6d4fa_:

  • d6d4fa_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18