Lineage for d6dsrb_ (6dsr B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413784Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2413882Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 2414001Protein Protozoan orotidine monophosphate decarboxylase [141749] (5 species)
  7. 2414009Species Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId:36329] [159376] (8 PDB entries)
  8. 3058833Domain d6dsrb_: 6dsr B: [358895]
    automated match to d2f84a1
    complexed with u5p

Details for d6dsrb_

PDB Entry: 6dsr (more details), 2.6 Å

PDB Description: re-refinement of p. falciparum orotidine 5'-monophosphate decarboxylase
PDB Compounds: (B:) orotidine 5'-monophosphate decarboxylase

SCOPe Domain Sequences for d6dsrb_:

Sequence, based on SEQRES records: (download)

>d6dsrb_ c.1.2.3 (B:) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId: 36329]}
mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
ypqkaaqmyydqinail

Sequence, based on observed residues (ATOM records): (download)

>d6dsrb_ c.1.2.3 (B:) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId: 36329]}
mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
dillkapdkseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlknvfdyl
yelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicydeeknkyy
safvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfvvgansy
demnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknpypqkaa
qmyydqinail

SCOPe Domain Coordinates for d6dsrb_:

Click to download the PDB-style file with coordinates for d6dsrb_.
(The format of our PDB-style files is described here.)

Timeline for d6dsrb_:

  • d6dsrb_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18