Lineage for d6ba0a_ (6ba0 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2477429Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2477430Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2477431Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins)
    automatically mapped to Pfam PF01156
  6. 2477472Protein automated matches [190287] (4 species)
    not a true protein
  7. 3058738Species Gardnerella vaginalis [TaxId:879307] [358800] (1 PDB entry)
  8. 3058829Domain d6ba0a_: 6ba0 A: [358891]
    automated match to d1masa_
    complexed with ca, cl

Details for d6ba0a_

PDB Entry: 6ba0 (more details), 2.03 Å

PDB Description: pyrimidine-specific ribonucleoside hydrolase from gardnerella vaginalis
PDB Compounds: (A:) Cytidine/uridine-specific hydrolase

SCOPe Domain Sequences for d6ba0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ba0a_ c.70.1.1 (A:) automated matches {Gardnerella vaginalis [TaxId: 879307]}
mttiildcdpghddamaillalgnpnidllgvttvggnqslekvtynaratlemahatni
pvhagcdrpmirplevaaavhgetgldgvtlpeptrpldeghavnwiidtimshepgtit
lvptgpltniamavrleprivsrvkevvlmgggyhvgnwsavaefnikvdpeaahvvfne
dwpitmvgldlthqalctpevqaridaigtplsafasglmdffrkayknnqdfidppvhd
pctvaylidhsvvqtrrcpvdveikgdltlgmtvadlrgpepsadkchtqvatkldfnkf
wdliidalkelk

SCOPe Domain Coordinates for d6ba0a_:

Click to download the PDB-style file with coordinates for d6ba0a_.
(The format of our PDB-style files is described here.)

Timeline for d6ba0a_:

  • d6ba0a_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18