SCOPe 2.08: Domain d6dx9b1: 6dx9 B:14-240

Lineage for d6dx9b1 (6dx9 B:14-240)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Equisetum arvense [TaxId:3258] [358873] (1 PDB entry)

8. Domain d6dx9b1: 6dx9 B:14-240 [358879]
   automated match to d1z1ea1
   complexed with csd

Details for d6dx9b1

PDB Entry: 6dx9, 1.5 Å

PDB Description: crystal structure of chalcone synthase from equisetum arvense

PDB Compounds: (B:) chalcone synthase

SCOPe Domain Sequences for d6dx9b1:

Sequence; same for both SEQRES and ATOM records:

>d6dx9b1 c.95.1.0 (B:14-240) automated matches {Equisetum arvense [TaxId: 3258]}
rlaqrangpatvlaigtanpanvfeqssypdfyfditnsqhmtelklkfsrmcqksgikk
rymhlnseilkanpslcayweksldvrqdiavvevpklgkeaslkaikewgqpkskithl
vfcttsgvdmpgadwaltkllglrpsvkrlmmyqqgcfaggtvlrvakdvaennkgarvl
vvcseitcvtfrgpsethldslvgqalfgdgaaavilgsdplpeenp

Timeline for d6dx9b1:

• d6dx9b1 first appeared in SCOPe 2.07