Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.70: Nucleoside hydrolase [53589] (1 superfamily) core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest |
Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) |
Family c.70.1.0: automated matches [191403] (1 protein) not a true family |
Protein automated matches [190539] (6 species) not a true protein |
Species Gardnerella vaginalis [TaxId:879307] [358801] (1 PDB entry) |
Domain d6ba1d_: 6ba1 D: [358877] automated match to d3mkna_ complexed with ca |
PDB Entry: 6ba1 (more details), 2.9 Å
SCOPe Domain Sequences for d6ba1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ba1d_ c.70.1.0 (D:) automated matches {Gardnerella vaginalis [TaxId: 879307]} kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr flnefmtrisglakia
Timeline for d6ba1d_: