Lineage for d6ba1d_ (6ba1 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510775Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2510776Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2510849Family c.70.1.0: automated matches [191403] (1 protein)
    not a true family
  6. 2510850Protein automated matches [190539] (6 species)
    not a true protein
  7. 2510865Species Gardnerella vaginalis [TaxId:879307] [358801] (1 PDB entry)
  8. 2510869Domain d6ba1d_: 6ba1 D: [358877]
    automated match to d3mkna_
    complexed with ca

Details for d6ba1d_

PDB Entry: 6ba1 (more details), 2.9 Å

PDB Description: purine-preferring ribonucleoside hydrolase from gardnerella vaginalis
PDB Compounds: (D:) Inosine-uridine preferring nucleoside hydrolase

SCOPe Domain Sequences for d6ba1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ba1d_ c.70.1.0 (D:) automated matches {Gardnerella vaginalis [TaxId: 879307]}
kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
flnefmtrisglakia

SCOPe Domain Coordinates for d6ba1d_:

Click to download the PDB-style file with coordinates for d6ba1d_.
(The format of our PDB-style files is described here.)

Timeline for d6ba1d_:

  • d6ba1d_ is new in SCOPe 2.07-stable
  • d6ba1d_ appears in the current release, SCOPe 2.08, called d6ba1d1