Lineage for d6dx9a2 (6dx9 A:241-405)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488301Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2488302Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2489065Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2489066Protein automated matches [196909] (67 species)
    not a true protein
  7. 3058811Species Equisetum arvense [TaxId:3258] [358873] (1 PDB entry)
  8. 3058813Domain d6dx9a2: 6dx9 A:241-405 [358875]
    automated match to d1z1ea2
    complexed with csd

Details for d6dx9a2

PDB Entry: 6dx9 (more details), 1.5 Å

PDB Description: crystal structure of chalcone synthase from equisetum arvense
PDB Compounds: (A:) chalcone synthase

SCOPe Domain Sequences for d6dx9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dx9a2 c.95.1.0 (A:241-405) automated matches {Equisetum arvense [TaxId: 3258]}
cfelhwsgsnilpdsdgaidghlrevgltfhlmkdvpgiisknigkvlndafrsafdesg
naedrpasvndifwiahpggpaildqveekmklapekmratrdvlseygnmssacvlfim
dhmrrmsaqnklqttgegldwgvllgfgpgltvetvllksirlac

SCOPe Domain Coordinates for d6dx9a2:

Click to download the PDB-style file with coordinates for d6dx9a2.
(The format of our PDB-style files is described here.)

Timeline for d6dx9a2:

  • d6dx9a2 appears in periodic updates to SCOPe 2.07 starting on 2018-10-18

View in 3D
Domains from same chain:
(mouse over for more information)
d6dx9a1