SCOPe 2.08: Domain d6dxbc2: 6dxb C:242-395

Lineage for d6dxbc2 (6dxb C:242-395)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (3 families)
Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
Protein automated matches [226868] (6 species)
not a true protein
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [358856] (3 PDB entries)
Domain d6dxbc2: 6dxb C:242-395 [358867]
automated match to d1bi5a2
complexed with csd

Details for d6dxbc2

PDB Entry: 6dxb (more details), 1.55 Å

PDB Description: crystal structure of chalcone synthase from arabidopsis thaliana

PDB Compounds: (C:) chalcone synthase

SCOPe Domain Sequences for d6dxbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dxbc2 c.95.1.2 (C:242-395) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ifemvsaaqtilpdsdgaidghlrevgltfhllkdvpglisknivksldeafkplgisdw
nslfwiahpggpaildqveiklglkeekmratrhvlseygnmssacvlfildemrrksak
dgvattgeglewgvlfgfgpgltvetvvlhsvpl

SCOPe Domain Coordinates for d6dxbc2:

Click to download the PDB-style file with coordinates for d6dxbc2.
(The format of our PDB-style files is described here.)

Timeline for d6dxbc2: