Lineage for d6bj0b4 (6bj0 B:422-562)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2581959Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2581998Family d.129.2.0: automated matches [254315] (1 protein)
    not a true family
  6. 2581999Protein automated matches [254722] (4 species)
    not a true protein
  7. 2582003Species Human (Homo sapiens) [TaxId:9606] [316258] (15 PDB entries)
  8. 2582019Domain d6bj0b4: 6bj0 B:422-562 [358863]
    Other proteins in same PDB: d6bj0a1, d6bj0a2, d6bj0a3, d6bj0a5, d6bj0b1, d6bj0b2, d6bj0b3, d6bj0b5
    automated match to d5jn5a4
    complexed with g6p, mg

Details for d6bj0b4

PDB Entry: 6bj0 (more details), 2.3 Å

PDB Description: crystal structure of wild-type human phosphoglucomutase 1 in complex with glucose-6-phosphate
PDB Compounds: (B:) Phosphoglucomutase-1

SCOPe Domain Sequences for d6bj0b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bj0b4 d.129.2.0 (B:422-562) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfrlsgtgsagatirlyidsyekdvakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

SCOPe Domain Coordinates for d6bj0b4:

Click to download the PDB-style file with coordinates for d6bj0b4.
(The format of our PDB-style files is described here.)

Timeline for d6bj0b4:

  • d6bj0b4 is new in SCOPe 2.07-stable
  • d6bj0b4 does not appear in SCOPe 2.08