Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) contains a single copy of this fold and an extra beta-strand at the C-terminus |
Family d.129.2.0: automated matches [254315] (1 protein) not a true family |
Protein automated matches [254722] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [316258] (15 PDB entries) |
Domain d6bj0b4: 6bj0 B:422-562 [358863] Other proteins in same PDB: d6bj0a1, d6bj0a2, d6bj0a3, d6bj0a5, d6bj0b1, d6bj0b2, d6bj0b3, d6bj0b5 automated match to d5jn5a4 complexed with g6p, mg |
PDB Entry: 6bj0 (more details), 2.3 Å
SCOPe Domain Sequences for d6bj0b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bj0b4 d.129.2.0 (B:422-562) automated matches {Human (Homo sapiens) [TaxId: 9606]} rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd gsisrnqglrliftdgsrivfrlsgtgsagatirlyidsyekdvakinqdpqvmlaplis ialkvsqlqertgrtaptvit
Timeline for d6bj0b4: