Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Bacteroides ovatus [TaxId:28116] [358842] (1 PDB entry) |
Domain d6d8kd1: 6d8k D:27-204 [358843] Other proteins in same PDB: d6d8kd2, d6d8kd3 automated match to d3k4aa1 |
PDB Entry: 6d8k (more details), 2.65 Å
SCOPe Domain Sequences for d6d8kd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d8kd1 b.18.1.0 (D:27-204) automated matches {Bacteroides ovatus [TaxId: 28116]} itnvygrdirslngkwnaiidlydqgrgmkvyrnqspkgntdfyeysfqgglrlnvpgdw nsqtpelkyyegtvwyarhfdakrlthkrqflyfgavsyrcrvylngaeigsheggftpf qievtdllnegenfiaievnnrrtkdaipamsfdwwnyggitrdvllvttpqtyledy
Timeline for d6d8kd1: