Lineage for d6d8kd1 (6d8k D:27-204)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775030Species Bacteroides ovatus [TaxId:28116] [358842] (1 PDB entry)
  8. 2775031Domain d6d8kd1: 6d8k D:27-204 [358843]
    Other proteins in same PDB: d6d8kd2, d6d8kd3
    automated match to d3k4aa1

Details for d6d8kd1

PDB Entry: 6d8k (more details), 2.65 Å

PDB Description: bacteroides multiple species beta-glucuronidase
PDB Compounds: (D:) Glycosyl hydrolase family 2, sugar binding domain protein

SCOPe Domain Sequences for d6d8kd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d8kd1 b.18.1.0 (D:27-204) automated matches {Bacteroides ovatus [TaxId: 28116]}
itnvygrdirslngkwnaiidlydqgrgmkvyrnqspkgntdfyeysfqgglrlnvpgdw
nsqtpelkyyegtvwyarhfdakrlthkrqflyfgavsyrcrvylngaeigsheggftpf
qievtdllnegenfiaievnnrrtkdaipamsfdwwnyggitrdvllvttpqtyledy

SCOPe Domain Coordinates for d6d8kd1:

Click to download the PDB-style file with coordinates for d6d8kd1.
(The format of our PDB-style files is described here.)

Timeline for d6d8kd1: