Lineage for d6dadb_ (6dad B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2319893Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2319950Protein Calmodulin [47516] (12 species)
  7. 2320038Species Human (Homo sapiens) [TaxId:9606] [47517] (98 PDB entries)
    Uniprot P02593
  8. 3058767Domain d6dadb_: 6dad B: [358829]
    automated match to d2n27a_
    complexed with ca

Details for d6dadb_

PDB Entry: 6dad (more details), 1.65 Å

PDB Description: 1.65 angstrom crystal structure of the n97i ca/cam:cav1.2 iq domain complex
PDB Compounds: (B:) Calmodulin-1

SCOPe Domain Sequences for d6dadb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dadb_ a.39.1.5 (B:) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmarkmkdtdseeeireafrvfdkdgigyisaaelrhvmtnlgekltdeevd
emireadidgdgqvnyeefvqmmt

SCOPe Domain Coordinates for d6dadb_:

Click to download the PDB-style file with coordinates for d6dadb_.
(The format of our PDB-style files is described here.)

Timeline for d6dadb_:

  • d6dadb_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18