Lineage for d6ba1i_ (6ba1 I:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2477429Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2477430Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2477498Family c.70.1.0: automated matches [191403] (1 protein)
    not a true family
  6. 2477499Protein automated matches [190539] (6 species)
    not a true protein
  7. 3058739Species Gardnerella vaginalis [TaxId:879307] [358801] (1 PDB entry)
  8. 3058750Domain d6ba1i_: 6ba1 I: [358812]
    automated match to d3mkna_
    complexed with ca

Details for d6ba1i_

PDB Entry: 6ba1 (more details), 2.9 Å

PDB Description: purine-preferring ribonucleoside hydrolase from gardnerella vaginalis
PDB Compounds: (I:) Inosine-uridine preferring nucleoside hydrolase

SCOPe Domain Sequences for d6ba1i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ba1i_ c.70.1.0 (I:) automated matches {Gardnerella vaginalis [TaxId: 879307]}
kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
flnefmtrisglakia

SCOPe Domain Coordinates for d6ba1i_:

Click to download the PDB-style file with coordinates for d6ba1i_.
(The format of our PDB-style files is described here.)

Timeline for d6ba1i_:

  • d6ba1i_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18