Lineage for d5yj2b2 (5yj2 B:159-310)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531295Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2531296Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2531550Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. 2531765Protein automated matches [254656] (4 species)
    not a true protein
  7. 2531842Species Bacillus sp. [TaxId:36824] [312567] (5 PDB entries)
  8. 3058735Domain d5yj2b2: 5yj2 B:159-310 [358797]
    automated match to d1j2ga2
    complexed with aza, mxe, oxy, so4

Details for d5yj2b2

PDB Entry: 5yj2 (more details), 1.71 Å

PDB Description: crystal structure of bacillus sp. tb-90 urate oxidase without dehydration
PDB Compounds: (B:) Uric acid degradation bifunctional protein

SCOPe Domain Sequences for d5yj2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yj2b2 d.96.1.4 (B:159-310) automated matches {Bacillus sp. [TaxId: 36824]}
dntlniteqqsglaglqlikvsgnsfvgfirdeyttlpedsnrplfvylnikwkyknted
sfgtnpenyvaaeqirdiatsvfhetetlsiqhliyligrrilerfpqlqevyfesqnht
wdkiveeipesegkvyteprppygfqcftvtq

SCOPe Domain Coordinates for d5yj2b2:

Click to download the PDB-style file with coordinates for d5yj2b2.
(The format of our PDB-style files is described here.)

Timeline for d5yj2b2:

  • d5yj2b2 appears in periodic updates to SCOPe 2.07 starting on 2018-10-11