Lineage for d5w9ad_ (5w9a D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502275Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2502297Protein automated matches [190358] (6 species)
    not a true protein
  7. 2502310Species Human (Homo sapiens) [TaxId:9606] [187279] (27 PDB entries)
  8. 3058722Domain d5w9ad_: 5w9a D: [358784]
    automated match to d5ms5b1
    complexed with zn

Details for d5w9ad_

PDB Entry: 5w9a (more details), 2.74 Å

PDB Description: the structure of the trim5alpha bbox- coiled coil in complex lc3b
PDB Compounds: (D:) Microtubule-associated proteins 1A/1B light chain 3B

SCOPe Domain Sequences for d5w9ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w9ad_ d.15.1.3 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmsel
ikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvyasq

SCOPe Domain Coordinates for d5w9ad_:

Click to download the PDB-style file with coordinates for d5w9ad_.
(The format of our PDB-style files is described here.)

Timeline for d5w9ad_:

  • d5w9ad_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11