Lineage for d5zila_ (5zil A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576670Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2576671Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2576672Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)
  6. 2576831Protein automated matches [190122] (7 species)
    not a true protein
  7. 2576859Species Halobacterium salinarum [TaxId:64091] [270103] (2 PDB entries)
  8. 3058673Domain d5zila_: 5zil A: [358735]
    automated match to d4x31a_
    complexed with l2p, ret

Details for d5zila_

PDB Entry: 5zil (more details), 1.29 Å

PDB Description: crystal structure of bacteriorhodopsin at 1.29 a resolution
PDB Compounds: (A:) bacteriorhodopsin

SCOPe Domain Sequences for d5zila_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zila_ f.13.1.1 (A:) automated matches {Halobacterium salinarum [TaxId: 64091]}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgea

SCOPe Domain Coordinates for d5zila_:

Click to download the PDB-style file with coordinates for d5zila_.
(The format of our PDB-style files is described here.)

Timeline for d5zila_:

  • d5zila_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11