Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins) automatically mapped to Pfam PF01014 |
Protein automated matches [254656] (4 species) not a true protein |
Species Bacillus sp. [TaxId:36824] [312567] (12 PDB entries) |
Domain d5yj2c1: 5yj2 C:8-158 [358733] automated match to d1j2ga1 complexed with aza, mxe, oxy, so4 |
PDB Entry: 5yj2 (more details), 1.71 Å
SCOPe Domain Sequences for d5yj2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yj2c1 d.96.1.4 (C:8-158) automated matches {Bacillus sp. [TaxId: 36824]} vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa vkngnraaselvfkksrneyataylnmvrne
Timeline for d5yj2c1: