Lineage for d5zima_ (5zim A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576670Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2576671Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2576672Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)
  6. 2576677Protein Bacteriorhodopsin [56871] (3 species)
    a light-driven proton pump
  7. 2576682Species Halobacterium salinarum [TaxId:2242] [56873] (98 PDB entries)
    Uniprot P02945 17-245
  8. 3058658Domain d5zima_: 5zim A: [358720]
    automated match to d1e0pa_
    complexed with l2p, ret

Details for d5zima_

PDB Entry: 5zim (more details), 1.25 Å

PDB Description: crystal structure of bacteriorhodopsin at 1.25 a resolution
PDB Compounds: (A:) bacteriorhodopsin

SCOPe Domain Sequences for d5zima_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zima_ f.13.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum [TaxId: 2242]}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge

SCOPe Domain Coordinates for d5zima_:

Click to download the PDB-style file with coordinates for d5zima_.
(The format of our PDB-style files is described here.)

Timeline for d5zima_:

  • d5zima_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11