Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (42 species) not a true protein |
Species Bacillus halodurans [TaxId:272558] [358672] (1 PDB entry) |
Domain d5wh9c_: 5wh9 C: [358703] automated match to d5v10b_ |
PDB Entry: 5wh9 (more details), 2.3 Å
SCOPe Domain Sequences for d5wh9c_:
Sequence, based on SEQRES records: (download)
>d5wh9c_ d.38.1.0 (C:) automated matches {Bacillus halodurans [TaxId: 272558]} kvyhfrvkfgdtdaagivfypnyykwmdeachhfltelgfptselidkkigfpiveatcq fkapllfadhvfirtsirelkdksfilehhfikqgrviasghekrvwanfsngklavcpi pssvrv
>d5wh9c_ d.38.1.0 (C:) automated matches {Bacillus halodurans [TaxId: 272558]} kvyhfrvkfgdtdaagivfypnyykwmdeachhfltelgfptselidkkigfpiveatcq fkapllfadhvfirtsirelkdksfilehhfikqgrviasghekrvwanfklavcpipss vrv
Timeline for d5wh9c_: