Lineage for d5wh9c_ (5wh9 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944350Species Bacillus halodurans [TaxId:272558] [358672] (1 PDB entry)
  8. 2944353Domain d5wh9c_: 5wh9 C: [358703]
    automated match to d5v10b_

Details for d5wh9c_

PDB Entry: 5wh9 (more details), 2.3 Å

PDB Description: structure of bh1999 gentisyl-coenzyme a thioesterase
PDB Compounds: (C:) 4-hydroxybenzoyl-CoA Thioesterase

SCOPe Domain Sequences for d5wh9c_:

Sequence, based on SEQRES records: (download)

>d5wh9c_ d.38.1.0 (C:) automated matches {Bacillus halodurans [TaxId: 272558]}
kvyhfrvkfgdtdaagivfypnyykwmdeachhfltelgfptselidkkigfpiveatcq
fkapllfadhvfirtsirelkdksfilehhfikqgrviasghekrvwanfsngklavcpi
pssvrv

Sequence, based on observed residues (ATOM records): (download)

>d5wh9c_ d.38.1.0 (C:) automated matches {Bacillus halodurans [TaxId: 272558]}
kvyhfrvkfgdtdaagivfypnyykwmdeachhfltelgfptselidkkigfpiveatcq
fkapllfadhvfirtsirelkdksfilehhfikqgrviasghekrvwanfklavcpipss
vrv

SCOPe Domain Coordinates for d5wh9c_:

Click to download the PDB-style file with coordinates for d5wh9c_.
(The format of our PDB-style files is described here.)

Timeline for d5wh9c_: