Lineage for d5zlqa_ (5zlq A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2412947Fold b.166: MAL13P1.257-like [141677] (1 superfamily)
    complex fold; duplication: consists of two intertwinned structural repeats related by pseudo dyad
  4. 2412948Superfamily b.166.1: MAL13P1.257-like [141678] (2 families) (S)
    automatically mapped to Pfam PF05907
  5. 3055562Family b.166.1.0: automated matches [355624] (1 protein)
    not a true family
  6. 3055563Protein automated matches [355625] (1 species)
    not a true protein
  7. 3055564Species Homo sapiens [TaxId:9606] [355626] (2 PDB entries)
  8. 3058636Domain d5zlqa_: 5zlq A: [358698]
    automated match to d1zsoa1
    complexed with zn

Details for d5zlqa_

PDB Entry: 5zlq (more details), 2 Å

PDB Description: crystal structure of c1orf123
PDB Compounds: (A:) UPF0587 protein C1orf123

SCOPe Domain Sequences for d5zlqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zlqa_ b.166.1.0 (A:) automated matches {Homo sapiens [TaxId: 9606]}
gkialqlkatlenitnlrpvgedfrwylkmkcgncgeisdkwqyirlmdsvalkggrgsa
smvqkcklcarensieilsstikpynaednenfktivefecrglepvdfqpqagfaaegv
esgtafsdinlqekdwtdydekaqesvgiyevthqfvkc

SCOPe Domain Coordinates for d5zlqa_:

Click to download the PDB-style file with coordinates for d5zlqa_.
(The format of our PDB-style files is described here.)

Timeline for d5zlqa_:

  • d5zlqa_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11