Lineage for d5zo8b1 (5zo8 B:17-367)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (139 species)
    not a true protein
  7. 2452278Species Human (Homo sapiens) [TaxId:9606] [186862] (137 PDB entries)
  8. 3058634Domain d5zo8b1: 5zo8 B:17-367 [358696]
    Other proteins in same PDB: d5zo8a2, d5zo8b2
    automated match to d3wpna_
    complexed with 4c5, adp, mg, na, so4

Details for d5zo8b1

PDB Entry: 5zo8 (more details), 2.2 Å

PDB Description: eg5 motor domain in complex with stlc-type inhibitor pvei0021 (p21 type)
PDB Compounds: (B:) Kinesin-like protein KIF11

SCOPe Domain Sequences for d5zo8b1:

Sequence, based on SEQRES records: (download)

>d5zo8b1 c.37.1.0 (B:17-367) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgast
kqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagii
prtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvii
kgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelv
kigklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphvpyreskl
trilqdslggrtrtsiiatispaslnleetlstleyahraknilnkpevnq

Sequence, based on observed residues (ATOM records): (download)

>d5zo8b1 c.37.1.0 (B:17-367) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtssrktytfdmvfgastkqidvy
rsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiiprtlhq
ifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviikgleei
tvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvkigkln
lvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsiiatis
paslnleetlstleyahraknilnkpevnq

SCOPe Domain Coordinates for d5zo8b1:

Click to download the PDB-style file with coordinates for d5zo8b1.
(The format of our PDB-style files is described here.)

Timeline for d5zo8b1:

  • d5zo8b1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-11

View in 3D
Domains from same chain:
(mouse over for more information)
d5zo8b2