Lineage for d5wh9a_ (5wh9 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2511612Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2511613Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2512375Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2512376Protein automated matches [190143] (38 species)
    not a true protein
  7. 3058610Species Bacillus halodurans [TaxId:272558] [358672] (1 PDB entry)
  8. 3058611Domain d5wh9a_: 5wh9 A: [358673]
    automated match to d5v10b_

Details for d5wh9a_

PDB Entry: 5wh9 (more details), 2.3 Å

PDB Description: structure of bh1999 gentisyl-coenzyme a thioesterase
PDB Compounds: (A:) 4-hydroxybenzoyl-CoA Thioesterase

SCOPe Domain Sequences for d5wh9a_:

Sequence, based on SEQRES records: (download)

>d5wh9a_ d.38.1.0 (A:) automated matches {Bacillus halodurans [TaxId: 272558]}
kvyhfrvkfgdtdaagivfypnyykwmdeachhfltelgfptselidkkigfpiveatcq
fkapllfadhvfirtsirelkdksfilehhfikqgrviasghekrvwanfsngklavcpi
pssvrvafan

Sequence, based on observed residues (ATOM records): (download)

>d5wh9a_ d.38.1.0 (A:) automated matches {Bacillus halodurans [TaxId: 272558]}
kvyhfrvkfgdtdaagivfypnyykwmdeachhfltelgfptselidkkigfpiveatcq
fkapllfadhvfirtsirelkdksfilehhfikqgrviasghekrvwacpipssvrvafa
n

SCOPe Domain Coordinates for d5wh9a_:

Click to download the PDB-style file with coordinates for d5wh9a_.
(The format of our PDB-style files is described here.)

Timeline for d5wh9a_:

  • d5wh9a_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11