Lineage for d5yhka_ (5yhk A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615725Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily)
    duplication: consists of two similar beta-alpha-beta(4) motifs
  4. 2615726Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families) (S)
    characteristic metal ion (zinc)-binding motif in the putative active site
  5. 2615752Family d.290.1.0: automated matches [191426] (1 protein)
    not a true family
  6. 2615753Protein automated matches [190613] (8 species)
    not a true protein
  7. 2615764Species Klebsiella aerogenes [TaxId:548] [358657] (3 PDB entries)
  8. 2615765Domain d5yhka_: 5yhk A: [358658]
    automated match to d1xv2a_
    complexed with cl, zn

Details for d5yhka_

PDB Entry: 5yhk (more details), 2.42 Å

PDB Description: crystal structure of acetolactate decarboxylase from enterbacter aerogenes
PDB Compounds: (A:) alpha-acetolactate decarboxylase

SCOPe Domain Sequences for d5yhka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yhka_ d.290.1.0 (A:) automated matches {Klebsiella aerogenes [TaxId: 548]}
sviyqtslmsallsgvyegdttiadllahgdfglgtfneldgemiafssqvyqlradgsa
raakpeqktpfavmtwfqpqyrktfdapvsrqqihdvidqqipsdnlfcalridgnfrha
htrtvprqtppyramtdvlddqpvfrfnqregvlvgfrtpqhmqginvagyhehfitddr
qggghlldyqlesgvltfgeihklmidlpadsaflqanlhpsnldaairsven

SCOPe Domain Coordinates for d5yhka_:

Click to download the PDB-style file with coordinates for d5yhka_.
(The format of our PDB-style files is described here.)

Timeline for d5yhka_:

  • d5yhka_ is new in SCOPe 2.07-stable
  • d5yhka_ does not appear in SCOPe 2.08