Lineage for d6h7fa_ (6h7f A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575768Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2575889Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2576115Family f.4.3.0: automated matches [267625] (1 protein)
    not a true family
  6. 2576116Protein automated matches [267676] (10 species)
    not a true protein
  7. 2576117Species Acinetobacter baumannii [TaxId:470] [317226] (4 PDB entries)
  8. 3058579Domain d6h7fa_: 6h7f A: [358641]
    automated match to d5fp1a_
    complexed with c8e, edo, fe, fv8, opv, opz

Details for d6h7fa_

PDB Entry: 6h7f (more details), 2.26 Å

PDB Description: crystal structure of baua, the ferric preacinetobactin receptor from acinetobacter baumannii in complex with fe3+-preacinetobactin- acinetobactin
PDB Compounds: (A:) BauA

SCOPe Domain Sequences for d6h7fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h7fa_ f.4.3.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
dtyaggqvatssnvgflgskkfldtpfntisytdkyiedkqakditeviaatdpsiytng
asggwsenyyirgyasstndmsmnglfgitpfyrtspemfgrvevlkgpsallngmppag
svggtvnlvtkyaadepfarltttymsdaqfgghvdvgrrfgenkefgvringmyrdgda
avndqskesrlfslgldwqgenarvfvdaydaldhvdgvtrgvnvstavgipkppkadtl
lspdwgsvetkdkgamirgeydfsdqlmayaaygqstteykyngasagtitsstgtlsst
lgqlafdvdkksadagfkgkfetgsvkhqwvanatyynhtqddygyriipgfsdpvitni
ydpnpnwgpkpeftppflfhstlstssfgladtlsfaqdkvqltlglrhqtvkatssvnt
lpenaksattpgvallikatdkisvyanyiegltkgdqapatasnpgeifppqktkqqel
glkvdlgtfahtlsafeitkpssyldpsklvnnlptfvsdgeqrnrgiewsffgspiehv
rlmggftyldpeltktksggndghtavavpknqaklgaewdtqvaqgtltlsgninavsk
qyinaentlsvpgrtlldvgarystkvedhpvtfraniynltnkaywaqpqltnlalgap
rtymlsvsydf

SCOPe Domain Coordinates for d6h7fa_:

Click to download the PDB-style file with coordinates for d6h7fa_.
(The format of our PDB-style files is described here.)

Timeline for d6h7fa_:

  • d6h7fa_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11