Lineage for d5wphc_ (5wph C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533769Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2533770Protein automated matches [190038] (46 species)
    not a true protein
  7. 2534007Species Pseudomonas putida [TaxId:160488] [334147] (2 PDB entries)
  8. 3058573Domain d5wphc_: 5wph C: [358635]
    automated match to d5jtfa_
    complexed with blj, na

Details for d5wphc_

PDB Entry: 5wph (more details), 2.19 Å

PDB Description: crystal structure of arsn, n-acetyltransferase with substrate ast from pseudomonas putida kt2440
PDB Compounds: (C:) Phosphinothricin N-acetyltransferase

SCOPe Domain Sequences for d5wphc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wphc_ d.108.1.0 (C:) automated matches {Pseudomonas putida [TaxId: 160488]}
gidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvavreg
rvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsayagi
alpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgfls

SCOPe Domain Coordinates for d5wphc_:

Click to download the PDB-style file with coordinates for d5wphc_.
(The format of our PDB-style files is described here.)

Timeline for d5wphc_:

  • d5wphc_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11