Lineage for d5niya2 (5niy A:285-496)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2449617Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2449909Protein automated matches [190304] (13 species)
    not a true protein
  7. 2449919Species Escherichia coli [TaxId:562] [187113] (3 PDB entries)
  8. 3058560Domain d5niya2: 5niy A:285-496 [358622]
    Other proteins in same PDB: d5niya1
    automated match to d2qy9a2
    complexed with gnp

Details for d5niya2

PDB Entry: 5niy (more details), 1.7 Å

PDB Description: signal recognition particle-docking protein ftsy
PDB Compounds: (A:) Signal recognition particle-docking protein FtsY

SCOPe Domain Sequences for d5niya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5niya2 c.37.1.10 (A:285-496) automated matches {Escherichia coli [TaxId: 562]}
plnvegkapfvilmvgvngvgktttigklarqfeqqgksvmlaagdtfraaaveqlqvwg
qrnnipviaqhtgadsasvifdaiqaakarnidvliadtagrlqnkshlmeelkkivrvm
kkldveaphevmltidastgqnavsqaklfheavgltgitltkldgtakggvifsvadqf
gipiryigvgeriedlrpfkaddfiealfare

SCOPe Domain Coordinates for d5niya2:

Click to download the PDB-style file with coordinates for d5niya2.
(The format of our PDB-style files is described here.)

Timeline for d5niya2:

  • d5niya2 appears in periodic updates to SCOPe 2.07 starting on 2018-10-11

View in 3D
Domains from same chain:
(mouse over for more information)
d5niya1