SCOPe 2.07: Domain d6mf9b_: 6mf9 B:

Lineage for d6mf9b_ (6mf9 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:353152] [224846] (2 PDB entries)

8. Domain d6mf9b_: 6mf9 B: [358610]
   automated match to d3gg3b_
   complexed with r78

Details for d6mf9b_

PDB Entry: 6mf9, 2.04 Å

PDB Description: crystal structure of cgd4-650 with compound bi2536

PDB Compounds: (B:) ZnKn (C2HC)+Athook+bromo domain protein, Taf250, transcription initiation factor IID

SCOPe Domain Sequences for d6mf9b_:

Sequence; same for both SEQRES and ATOM records:

>d6mf9b_ a.29.2.0 (B:) automated matches {Cryptosporidium parvum [TaxId: 353152]}
gpnitsytealdefcielqriinstktlhhyshvfwnrvseriapnyynlvkrpmwlqlm
inkckkreyksrkdfqddldlivenckiyngvnhplvsvatlihsnvvkkideiqgieki
eaylslk

Timeline for d6mf9b_:

• d6mf9b_ is new in SCOPe 2.07-stable
  
• d6mf9b_ appears in the current release, SCOPe 2.08