Lineage for d6mf9b_ (6mf9 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316976Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2316977Protein automated matches [190615] (11 species)
    not a true protein
  7. 2316981Species Cryptosporidium parvum [TaxId:353152] [224846] (2 PDB entries)
  8. 3058548Domain d6mf9b_: 6mf9 B: [358610]
    automated match to d3gg3b_
    complexed with r78

Details for d6mf9b_

PDB Entry: 6mf9 (more details), 2.04 Å

PDB Description: crystal structure of cgd4-650 with compound bi2536
PDB Compounds: (B:) ZnKn (C2HC)+Athook+bromo domain protein, Taf250, transcription initiation factor IID

SCOPe Domain Sequences for d6mf9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mf9b_ a.29.2.0 (B:) automated matches {Cryptosporidium parvum [TaxId: 353152]}
gpnitsytealdefcielqriinstktlhhyshvfwnrvseriapnyynlvkrpmwlqlm
inkckkreyksrkdfqddldlivenckiyngvnhplvsvatlihsnvvkkideiqgieki
eaylslk

SCOPe Domain Coordinates for d6mf9b_:

Click to download the PDB-style file with coordinates for d6mf9b_.
(The format of our PDB-style files is described here.)

Timeline for d6mf9b_:

  • d6mf9b_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11