Lineage for d6hcpb_ (6hcp B:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575768Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2575889Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2576115Family f.4.3.0: automated matches [267625] (1 protein)
    not a true family
  6. 2576116Protein automated matches [267676] (10 species)
    not a true protein
  7. 2576117Species Acinetobacter baumannii [TaxId:470] [317226] (4 PDB entries)
  8. 3058546Domain d6hcpb_: 6hcp B: [358608]
    automated match to d5fp1a_
    complexed with c8e, edo, po4

Details for d6hcpb_

PDB Entry: 6hcp (more details), 1.83 Å

PDB Description: crystal structure of baua, the ferric preacinetobactin receptor from acinetobacter baumannii
PDB Compounds: (B:) BauA

SCOPe Domain Sequences for d6hcpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hcpb_ f.4.3.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
dtyaggqvatssnvgflgskkfldtpfntisytdkyiedkqakditeviaatdpsiytng
asggwsenyyirgyasstndmsmnglfgitpfyrtspemfgrvevlkgpsallngmppag
svggtvnlvtkyaadepfarltttymsdaqfgghvdvgrrfgenkefgvringmyrdgda
avndqskesrlfslgldwqgenarvfvdaydaldhvdgvtrgvnvstavgipkppkadtl
lspdwgsvetkdkgamirgeydfsdqlmayaaygqstteykyngasagtitsstgtlsst
lgqlafdvdkksadagfkgkfetgsvkhqwvanatyynhtqddygyriipgfsdpvitni
ydpnpnwgpkpeftppflfhstlstssfgladtlsfaqdkvqltlglrhqtvkatssvnt
lpenaksattpgvallikatdkisvyanyiegltkgdqapatasnpgeifppqktkqqel
glkvdlgtfahtlsafeitkpssyldpsklvnnlptfvsdgeqrnrgiewsffgspiehv
rlmggftyldpeltktksggndghtavavpknqaklgaewdtqvaqgtltlsgninavsk
qyinaentlsvpgrtlldvgarystkvedhpvtfraniynltnkaywaqpqltnlalgap
rtymlsvsydf

SCOPe Domain Coordinates for d6hcpb_:

Click to download the PDB-style file with coordinates for d6hcpb_.
(The format of our PDB-style files is described here.)

Timeline for d6hcpb_:

  • d6hcpb_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11