Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries) |
Domain d5ovba1: 5ovb A:44-167 [358596] Other proteins in same PDB: d5ovba2, d5ovbb2 automated match to d6czua_ protein/DNA complex; complexed with ay2 |
PDB Entry: 5ovb (more details), 1.95 Å
SCOPe Domain Sequences for d5ovba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ovba1 a.29.2.0 (A:44-167) automated matches {Human (Homo sapiens) [TaxId: 9606]} nppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykiikt pmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkine lpte
Timeline for d5ovba1: