Lineage for d6czfd2 (6czf D:250-494)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467648Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2467649Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2467650Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2468033Protein automated matches [190074] (15 species)
    not a true protein
  7. 3058371Species Escherichia coli [TaxId:83333] [358433] (1 PDB entry)
  8. 3058527Domain d6czfd2: 6czf D:250-494 [358589]
    Other proteins in same PDB: d6czfb1, d6czfd1
    automated match to d1ecba1
    complexed with g4p, mg

Details for d6czfd2

PDB Entry: 6czf (more details), 1.95 Å

PDB Description: the structure of e. coli purf in complex with ppgpp-mg
PDB Compounds: (D:) Amidophosphoribosyltransferase

SCOPe Domain Sequences for d6czfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6czfd2 c.61.1.1 (D:250-494) automated matches {Escherichia coli [TaxId: 83333]}
npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia
leiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdknvllvddsi
vrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqii
gadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldtlrnddakav
qrqne

SCOPe Domain Coordinates for d6czfd2:

Click to download the PDB-style file with coordinates for d6czfd2.
(The format of our PDB-style files is described here.)

Timeline for d6czfd2:

  • d6czfd2 appears in periodic updates to SCOPe 2.07 starting on 2018-10-11

View in 3D
Domains from same chain:
(mouse over for more information)
d6czfd1