Lineage for d5ow2a_ (5ow2 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341770Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily)
    core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices
  4. 2341771Superfamily a.190.1: Flavivirus capsid protein C [101257] (2 families) (S)
    automatically mapped to Pfam PF01003
  5. 3048743Family a.190.1.0: automated matches [348805] (1 protein)
    not a true family
  6. 3048744Protein automated matches [348806] (2 species)
    not a true protein
  7. 3058482Species Japanese encephalitis virus (strain sa-14) [TaxId:11073] [358544] (1 PDB entry)
  8. 3058483Domain d5ow2a_: 5ow2 A: [358545]
    automated match to d1sfka_
    complexed with edo, flc

Details for d5ow2a_

PDB Entry: 5ow2 (more details), 1.98 Å

PDB Description: japanese encephalitis virus capsid protein
PDB Compounds: (A:) capsid protein

SCOPe Domain Sequences for d5ow2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ow2a_ a.190.1.0 (A:) automated matches {Japanese encephalitis virus (strain sa-14) [TaxId: 11073]}
plvgvkrvvmslldgrgpvrfvlalitffkftalaptkallgrwkaveksvamkhltsfk
relgtlidavnkr

SCOPe Domain Coordinates for d5ow2a_:

Click to download the PDB-style file with coordinates for d5ow2a_.
(The format of our PDB-style files is described here.)

Timeline for d5ow2a_:

  • d5ow2a_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11