Lineage for d6mh3a1 (6mh3 A:183-481)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2450935Family c.37.1.14: RNA helicase [52724] (4 proteins)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 2451014Protein automated matches [226986] (8 species)
    not a true protein
  7. 2451045Species Zika virus (strain mr 766) [TaxId:64320] [327262] (5 PDB entries)
  8. 3058472Domain d6mh3a1: 6mh3 A:183-481 [358533]
    Other proteins in same PDB: d6mh3a2
    automated match to d5jpsa1
    complexed with edo, mpd, po4

Details for d6mh3a1

PDB Entry: 6mh3 (more details), 1.92 Å

PDB Description: the crystal structure of zika virus ns3 helicase domain
PDB Compounds: (A:) Zika virus NS3 helicase domain

SCOPe Domain Sequences for d6mh3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mh3a1 c.37.1.14 (A:183-481) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
mlkkkqltvldlhpgagktrrvlpeivreaikkrlrtvilaptrvvaaemeealrglpvr
ymttavnvthsgteivdlmchatftsrllqpirvpnynlnimdeahftdpssiaargyis
trvemgeaaaifmtatppgtrdafpdsnspimdtevevperawssgfdwvtdhsgktvwf
vpsvrngneiaacltkagkrviqlsrktfetefqktknqewdfvittdisemganfkadr
vidsrrclkpvildgervilagpmpvthasaaqrrgrigrnpnkpgdeymygggcaetd

SCOPe Domain Coordinates for d6mh3a1:

Click to download the PDB-style file with coordinates for d6mh3a1.
(The format of our PDB-style files is described here.)

Timeline for d6mh3a1:

  • d6mh3a1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-11

View in 3D
Domains from same chain:
(mouse over for more information)
d6mh3a2