Lineage for d6fafb_ (6faf B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401367Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2401368Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2401369Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2402230Protein automated matches [190681] (2 species)
    not a true protein
  7. 2402240Species Human (Homo sapiens) [TaxId:9606] [187805] (37 PDB entries)
  8. 3058469Domain d6fafb_: 6faf B: [358531]
    automated match to d3d0na_
    complexed with d3b, gol, zn

Details for d6fafb_

PDB Entry: 6faf (more details), 1.99 Å

PDB Description: crystal structure of human carbonic anhydrase i in complex with the 3- (2,5-dimethylphenyl)-1-(2-hydroxy-5-sulfamoylphenyl)urea inhibitor
PDB Compounds: (B:) Carbonic anhydrase 1

SCOPe Domain Sequences for d6fafb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fafb_ b.74.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
nnrptqplkgrtvrasf

SCOPe Domain Coordinates for d6fafb_:

Click to download the PDB-style file with coordinates for d6fafb_.
(The format of our PDB-style files is described here.)

Timeline for d6fafb_:

  • d6fafb_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11