![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) ![]() crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site |
![]() | Family a.25.2.0: automated matches [191442] (1 protein) not a true family |
![]() | Protein automated matches [190652] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187855] (3 PDB entries) |
![]() | Domain d6d5xb_: 6d5x B: [358527] automated match to d2idxb_ complexed with 3po, 5ad, atp, b12, mg, so4 |
PDB Entry: 6d5x (more details), 2.4 Å
SCOPe Domain Sequences for d6d5xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d5xb_ a.25.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kiytktgdkgfsstftgerrpkddqvfeavgttdelssaigfalelvtekghtfaeelqk iqctlqdvgsalatpcssareahlkyttfkagpileleqwidkytsqlppltafilpsgg kissalhfcravcrraerrvvplvqmgetdanvakflnrlsdylftlaryaamkegnqek iym
Timeline for d6d5xb_: