Lineage for d6a3wk_ (6a3w K:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (194 PDB entries)
  8. 3058451Domain d6a3wk_: 6a3w K: [358513]
    Other proteins in same PDB: d6a3wa_, d6a3wd_, d6a3wg_, d6a3wj_
    automated match to d4aj0b_
    complexed with nag

Details for d6a3wk_

PDB Entry: 6a3w (more details), 2 Å

PDB Description: complex structure of 4-1bb and utomilumab
PDB Compounds: (K:) utomilumab VL

SCOPe Domain Sequences for d6a3wk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a3wk_ b.1.1.1 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqppsvsvspgqtasitcsgdnigdqyahwyqqkpgqspvlviyqdknrpsgiperf
sgsnsgntatltisgtqamdeadyycatytgfgslavfgggtkltvl

SCOPe Domain Coordinates for d6a3wk_:

Click to download the PDB-style file with coordinates for d6a3wk_.
(The format of our PDB-style files is described here.)

Timeline for d6a3wk_:

  • d6a3wk_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11