Lineage for d6fwta_ (6fwt A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473281Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2473282Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2473291Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)
  6. 2473351Protein automated matches [190297] (2 species)
    not a true protein
  7. 2473355Species Human (Homo sapiens) [TaxId:9606] [187395] (19 PDB entries)
  8. 3058442Domain d6fwta_: 6fwt A: [358504]
    automated match to d4l41c_
    complexed with gol

Details for d6fwta_

PDB Entry: 6fwt (more details), 1.85 Å

PDB Description: crystal structure of human wild type beta-1,4-galactosyltransferase-1 (b4galt1) in apo-open monomeric form
PDB Compounds: (A:) Beta-1,4-galactosyltransferase 1

SCOPe Domain Sequences for d6fwta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fwta_ c.68.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttalslpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvaii
ipfrnrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdydy
tcfvfsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqfltin
gfpnnywgwggedddifnrlvfrgmsisrpnavvgrcrmirhsrdkknepnpqrfdriah
tketmlsdglnsltyqvldvqryplytqitvdigtps

SCOPe Domain Coordinates for d6fwta_:

Click to download the PDB-style file with coordinates for d6fwta_.
(The format of our PDB-style files is described here.)

Timeline for d6fwta_:

  • d6fwta_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11