Lineage for d6fjsa_ (6fjs A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2453146Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2453147Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2453148Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 2453186Protein Proteinase K [52762] (1 species)
  7. 2453187Species Fungus (Tritirachium album), strain limber [TaxId:37998] [52763] (44 PDB entries)
    Uniprot P06873
  8. 3058439Domain d6fjsa_: 6fjs A: [358501]
    automated match to d1ic6a_
    complexed with ca

Details for d6fjsa_

PDB Entry: 6fjs (more details), 1.9 Å

PDB Description: proteinase~k siras phased structure of room-temperature, serially collected synchrotron data
PDB Compounds: (A:) Proteinase K

SCOPe Domain Sequences for d6fjsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fjsa_ c.41.1.1 (A:) Proteinase K {Fungus (Tritirachium album), strain limber [TaxId: 37998]}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtdilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

SCOPe Domain Coordinates for d6fjsa_:

Click to download the PDB-style file with coordinates for d6fjsa_.
(The format of our PDB-style files is described here.)

Timeline for d6fjsa_:

  • d6fjsa_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11