Lineage for d6buhe_ (6buh E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316392Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2316393Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2316508Family a.28.1.3: apo-D-alanyl carrier protein [63535] (1 protein)
    automatically mapped to Pfam PF00550
  6. 2316509Protein apo-D-alanyl carrier protein [63536] (2 species)
  7. 3058350Species Streptococcus thermophilus [TaxId:1308] [358412] (1 PDB entry)
  8. 3058438Domain d6buhe_: 6buh E: [358500]
    automated match to d1hqba_

Details for d6buhe_

PDB Entry: 6buh (more details), 3.15 Å

PDB Description: crystal structure of a membrane protein, crystal form ii
PDB Compounds: (E:) D-alanyl carrier protein

SCOPe Domain Sequences for d6buhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6buhe_ a.28.1.3 (E:) apo-D-alanyl carrier protein {Streptococcus thermophilus [TaxId: 1308]}
mdvkaevieiidelfmedvsdmmdedlfdagvldsmgtvelivelesrfdirvpvsefgr
ddwntankivegvtelrna

SCOPe Domain Coordinates for d6buhe_:

Click to download the PDB-style file with coordinates for d6buhe_.
(The format of our PDB-style files is described here.)

Timeline for d6buhe_:

  • d6buhe_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11