Lineage for d6ehab_ (6eha B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338543Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2338544Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2338545Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 2338591Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 2338592Species Human (Homo sapiens) [TaxId:9606] [48616] (26 PDB entries)
    Uniprot P09601
  8. 3058426Domain d6ehab_: 6eha B: [358488]
    automated match to d1ix3a_
    complexed with b5b, hem

Details for d6ehab_

PDB Entry: 6eha (more details), 2 Å

PDB Description: heme oxygenase 1 in complex with inhibitor
PDB Compounds: (B:) Heme oxygenase 1

SCOPe Domain Sequences for d6ehab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ehab_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOPe Domain Coordinates for d6ehab_:

Click to download the PDB-style file with coordinates for d6ehab_.
(The format of our PDB-style files is described here.)

Timeline for d6ehab_:

  • d6ehab_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11