Lineage for d6b3ib_ (6b3i B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325642Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2325643Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2325759Family a.65.1.0: automated matches [191494] (1 protein)
    not a true family
  6. 2325760Protein automated matches [190800] (1 species)
    not a true protein
  7. 2325761Species Human (Homo sapiens) [TaxId:9606] [188064] (6 PDB entries)
  8. 3058422Domain d6b3ib_: 6b3i B: [358484]
    automated match to d1aiia_
    complexed with edo

Details for d6b3ib_

PDB Entry: 6b3i (more details), 2.6 Å

PDB Description: annexin a13a
PDB Compounds: (B:) Annexin

SCOPe Domain Sequences for d6b3ib_:

Sequence, based on SEQRES records: (download)

>d6b3ib_ a.65.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qgfdvdrdakklnkackgmgtneaaiieilsgrtsderqqikqkykatygkeleevlkse
lsgnfektalalldhpseyaarqlqkamkglgtdesvlievlctrtnkeiiaikeayqrl
fdrslesdvkgdtsgnlkkilvsllqanrnegddvdkdlagqdakdlydagegrwgtdel
afnevlakrsykqlratfqayqiligkdieeaieeetsgdlqkayltlvrcaqdcedyfa
erlyksmkgagtdeetliriivtraevdlqgikakfqekyqkslsdmvrsdtsgdfrkll
vallh

Sequence, based on observed residues (ATOM records): (download)

>d6b3ib_ a.65.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qgfdvdrdakklnkackgmgtneaaiieilsgrtsderqqikqkykatygkeleevlkse
lsgnfektalalldhpseyaarqlqkamkglgtdesvlievlctrtnkeiiaikeayqrl
fdrslesdvkgdtsgnlkkilvsllqanrnegddvdkdlagqdakdlydagegrwdelaf
nevlakrsykqlratfqayqiligkdieeaieeetsgdlqkayltlvrcaqdcedyfaer
lyksmkgagtdeetliriivtraevdlqgikakfqekyqkslsdmvrsdtsgdfrkllva
llh

SCOPe Domain Coordinates for d6b3ib_:

Click to download the PDB-style file with coordinates for d6b3ib_.
(The format of our PDB-style files is described here.)

Timeline for d6b3ib_:

  • d6b3ib_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11