Lineage for d6egra_ (6egr A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2471297Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2471550Protein automated matches [190399] (9 species)
    not a true protein
  7. 2471553Species Citrobacter freundii [TaxId:546] [261234] (6 PDB entries)
  8. 3058414Domain d6egra_: 6egr A: [358476]
    automated match to d1y4ia1
    complexed with peg, pge, plp

Details for d6egra_

PDB Entry: 6egr (more details), 1.45 Å

PDB Description: crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement
PDB Compounds: (A:) methionine gamma-lyase

SCOPe Domain Sequences for d6egra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6egra_ c.67.1.3 (A:) automated matches {Citrobacter freundii [TaxId: 546]}
sdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytrl
gnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthafls
hsmpkfginvsfvdaakpeeiraamrpetkvvyietpanptlslvdietvagiahqqgal
lvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkdi
tggcmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqyel
gqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspyape
erlkagitdglirlsvgledpediindlehairkat

SCOPe Domain Coordinates for d6egra_:

Click to download the PDB-style file with coordinates for d6egra_.
(The format of our PDB-style files is described here.)

Timeline for d6egra_:

  • d6egra_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11