Lineage for d6eh0a_ (6eh0 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542663Protein cAMP-dependent PK, catalytic subunit [56116] (7 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 3046606Species Cricetulus griseus [TaxId:10029] [346668] (19 PDB entries)
  8. 3058411Domain d6eh0a_: 6eh0 A: [358473]
    automated match to d1smha_

Details for d6eh0a_

PDB Entry: 6eh0 (more details), 1.49 Å

PDB Description: apo crystal structure of the protein-kinase a catalytic subunit from criteculus
PDB Compounds: (A:) cAMP-dependent protein kinase catalytic subunit alpha

SCOPe Domain Sequences for d6eh0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eh0a_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Cricetulus griseus [TaxId: 10029]}
qesvkeflakakeeflkkwespsqntaqldhfdriktlgtgsfgrvmlvkhketgnhyam
kildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfsh
lrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrv
kgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekiv
sgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkve
apfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef

SCOPe Domain Coordinates for d6eh0a_:

Click to download the PDB-style file with coordinates for d6eh0a_.
(The format of our PDB-style files is described here.)

Timeline for d6eh0a_:

  • d6eh0a_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11