Lineage for d6egya_ (6egy A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303644Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2303645Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2303646Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2303863Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2303867Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (78 PDB entries)
    Uniprot P00044
  8. 3058409Domain d6egya_: 6egy A: [358471]
    automated match to d5t8wa_
    complexed with b4t, hem, so4

Details for d6egya_

PDB Entry: 6egy (more details), 2.7 Å

PDB Description: crystal structure of cytochrome c in complex with mono-pegylated sulfonatocalix[4]arene
PDB Compounds: (A:) Cytochrome c iso-1

SCOPe Domain Sequences for d6egya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6egya_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

SCOPe Domain Coordinates for d6egya_:

Click to download the PDB-style file with coordinates for d6egya_.
(The format of our PDB-style files is described here.)

Timeline for d6egya_:

  • d6egya_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11