Lineage for d6cg9b1 (6cg9 B:4-254)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413228Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2413631Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2413632Protein automated matches [190605] (22 species)
    not a true protein
  7. 3058389Species Zea mays [TaxId:4577] [358451] (1 PDB entry)
  8. 3058405Domain d6cg9b1: 6cg9 B:4-254 [358467]
    Other proteins in same PDB: d6cg9b2
    automated match to d4mkna_
    complexed with act, gol

Details for d6cg9b1

PDB Entry: 6cg9 (more details), 1.8 Å

PDB Description: crystal structure of triosephosphate isomerase from zea mays (mexican corn)
PDB Compounds: (B:) Triosephosphate isomerase, cytosolic

SCOPe Domain Sequences for d6cg9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cg9b1 c.1.1.0 (B:4-254) automated matches {Zea mays [TaxId: 4577]}
mgrkffvggnwkcngttdqvekivktlnegqvppsdvvevvvsppyvflpvvksqlrqef
hvaaqncwvkkggaftgevsaemlvnlgvpwvilghserrallgesnefvgdkvayalsq
glkviacvgetleqreagstmdvvaaqtkaiaekikdwsnvvvayepvwaigtgkvatpa
qaqevhaslrdwlktnaspevaestriiyggsvtaanckelaaqpdvdgflvggaslkpe
fidiinaatvk

SCOPe Domain Coordinates for d6cg9b1:

Click to download the PDB-style file with coordinates for d6cg9b1.
(The format of our PDB-style files is described here.)

Timeline for d6cg9b1:

  • d6cg9b1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-11

View in 3D
Domains from same chain:
(mouse over for more information)
d6cg9b2
View in 3D
Domains from other chains:
(mouse over for more information)
d6cg9a_