SCOPe 2.08: Domain d6cyla2: 6cyl A:91-200

Lineage for d6cyla2 (6cyl A:91-200)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Hypocrea jecorina [TaxId:431241] [340063] (6 PDB entries)

8. Domain d6cyla2: 6cyl A:91-200 [358463]
   Other proteins in same PDB: d6cyla1, d6cylb1, d6cylc1, d6cyld1
   automated match to d5tira2
   complexed with mn; mutant

Details for d6cyla2

PDB Entry: 6cyl, 1.8 Å

PDB Description: crystal structure of superoxide dismutase double mutant (g74q+q149g) from trichoderma reesei

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d6cyla2:

Sequence; same for both SEQRES and ATOM records:

>d6cyla2 d.44.1.0 (A:91-200) automated matches {Hypocrea jecorina [TaxId: 431241]}
pdadpasapeltaeiaktwgsldkfkeamgkallgiqgsgwgwlvkegsglrivttkdgd
pvvggevpvfgidmwehayylqylngkaayvdniwkvinwktaeqrfkgd

Timeline for d6cyla2:

• d6cyla2 first appeared in SCOPe 2.07