Lineage for d6cyqf_ (6cyq F:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2568473Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2569281Protein automated matches [190161] (25 species)
    not a true protein
  7. 2569346Species Escherichia coli [TaxId:562] [187306] (70 PDB entries)
  8. 3058398Domain d6cyqf_: 6cyq F: [358460]
    automated match to d4pm5a_
    complexed with ce4, gol

Details for d6cyqf_

PDB Entry: 6cyq (more details), 1.7 Å

PDB Description: crystal structure of ctx-m-14 s70g/n106s beta-lactamase in complex with hydrolyzed cefotaxime
PDB Compounds: (F:) Beta-lactamase

SCOPe Domain Sequences for d6cyqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cyqf_ e.3.1.1 (F:) automated matches {Escherichia coli [TaxId: 562]}
savqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqsetq
kqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggpgg
vtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraql
vtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqpq
qnaesrrdvlasaariiaeg

SCOPe Domain Coordinates for d6cyqf_:

Click to download the PDB-style file with coordinates for d6cyqf_.
(The format of our PDB-style files is described here.)

Timeline for d6cyqf_:

  • d6cyqf_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11