Lineage for d6agqd_ (6agq D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902617Species Paenibacillus sp. [TaxId:1079050] [358406] (1 PDB entry)
  8. 2902621Domain d6agqd_: 6agq D: [358453]
    automated match to d3fvri_
    complexed with zn

Details for d6agqd_

PDB Entry: 6agq (more details), 2.1 Å

PDB Description: acetyl xylan esterase from paenibacillus sp. r4
PDB Compounds: (D:) acetyl xylan esterase

SCOPe Domain Sequences for d6agqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6agqd_ c.69.1.0 (D:) automated matches {Paenibacillus sp. [TaxId: 1079050]}
mplsqlqdykpeltnetdfdlfwdnakalsnqkplhaqvnlvqdyplksisiydvvydga
dgtpihgwyvtpkgehqpgslpvlvkyhgysgnrgypnellqwasmgmaalaidvrgqgg
vtpdraeypqggipgwmtlgildpasyyykqvyldciraldfvcsreevdasriavyggs
qggglalaaagldsrpklalpvfpflchfrrsveihasgpyveiknwfrrydpehrqeeq
vyrtlsyfdgmnmasrikartlmaitlqditcppstcfaaynhlagpkevrlyhdygheg
lpfheeammrfieayl

SCOPe Domain Coordinates for d6agqd_:

Click to download the PDB-style file with coordinates for d6agqd_.
(The format of our PDB-style files is described here.)

Timeline for d6agqd_: