Lineage for d6dura_ (6dur A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2471247Family c.67.1.2: Beta-eliminating lyases [53397] (3 proteins)
  6. 2471277Protein automated matches [190632] (1 species)
    not a true protein
  7. 2471278Species Citrobacter freundii [TaxId:546] [187681] (13 PDB entries)
  8. 3058387Domain d6dura_: 6dur A: [358449]
    automated match to d2vlfa_
    complexed with k, p33, p70, p71, pge

Details for d6dura_

PDB Entry: 6dur (more details), 1.8 Å

PDB Description: citrobacter freundii tyrosine phenol-lyase complexed with l- phenylalanine
PDB Compounds: (A:) tyrosine phenol-lyase

SCOPe Domain Sequences for d6dura_:

Sequence, based on SEQRES records: (download)

>d6dura_ c.67.1.2 (A:) automated matches {Citrobacter freundii [TaxId: 546]}
nypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqw
agmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagnm
yftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicla
vtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaeiv
hemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmea
maiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdef
paqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvva
dgiiklyqhkedirglkfiyepkqlrfftarfdyi

Sequence, based on observed residues (ATOM records): (download)

>d6dura_ c.67.1.2 (A:) automated matches {Citrobacter freundii [TaxId: 546]}
nypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqw
agmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagnm
yftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicla
vtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaeiv
hemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmea
maiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdef
paqslaasiyvetgvrsmergiisagrnnvhhrpkletvrltiprrvytyahmdvvadgi
iklyqhkedirglkfiyepkqlrfftarfdyi

SCOPe Domain Coordinates for d6dura_:

Click to download the PDB-style file with coordinates for d6dura_.
(The format of our PDB-style files is described here.)

Timeline for d6dura_:

  • d6dura_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11