Lineage for d6cynd_ (6cyn D:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2568473Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2569281Protein automated matches [190161] (25 species)
    not a true protein
  7. 2569346Species Escherichia coli [TaxId:562] [187306] (70 PDB entries)
  8. 3058379Domain d6cynd_: 6cyn D: [358441]
    automated match to d1ylwa_
    mutant

Details for d6cynd_

PDB Entry: 6cyn (more details), 1.6 Å

PDB Description: ctx-m-14 n106s/d240g mutant
PDB Compounds: (D:) Beta-lactamase

SCOPe Domain Sequences for d6cynd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cynd_ e.3.1.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
qkqllnqpveikpadlvnyspiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
lvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftqp
qqnaesrrdvlasaariiaeg

SCOPe Domain Coordinates for d6cynd_:

Click to download the PDB-style file with coordinates for d6cynd_.
(The format of our PDB-style files is described here.)

Timeline for d6cynd_:

  • d6cynd_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11